DPCstruct | MC1245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 215 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 23.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 96.98 |
| Assigned Pfam label(s) | CL0715- PF09440- PF04782- PF00118- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813KDD0 | 15-135 | DVRSSNILAARAVADTIRTSLGPKGMDKMIQEANGQVMISNDGATILEKMKLTHPTARMMAELSRAQDIEAGDGTTTVVVLAGALLQ… |
| A0A7J7NIV3 | 17-174 | NLRSLPEGMESLTSLRSLSKFIIGVNKLADLVGVTLGPKGRNVVLENKYGSPKIINNGVTVAKEVELEDLVKNIGVKLVRQGDANTN… |
| A0A0E0GQ21 | 17-192 | None |
| A0A287PM10 | 230-402 | None |
| A0A1V6T0Q3 | 444-601 | None |
| A0A835HBS4 | 2-167 | None |
| A0A5P1FAD8 | 2-100 | None |
| A0A1Z5SAH0 | 514-676 | None |
| A0A5B7DD06 | 538-707 | None |
| L9KKW1 | 7-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.