DPCstruct | MC12449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1ZB79 | 1-105 | MKKRLRKKKYIGEFQEFGWYVTLVLKNDDAQTKEALREPLLEQMDALDLMMGGSIVSFFVQPVVRMSQEQTQDRQQQLQQWLTQRPE… |
| A0A5C8B7L8 | 5-105 | RSRRQRKKLHVGEFQEFGFAFKTQLKEGAREELFVDALLEEVIEPKGLEFGGWAHGGFITKSERGSVSAQERAALIDWLRARSDVAS… |
| A0A378WJ80 | 19-124 | None |
| A0A285VAN9 | 19-107 | None |
| A0A519MJI0 | 20-127 | None |
| A0A426CIS9 | 1-117 | None |
| Q5NX72 | 45-147 | None |
| A0A2U3KHV4 | 491-601 | None |
| A0A4R7B669 | 16-121 | None |
| A0A519TNG4 | 11-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.