DPCstruct | MC12440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061P5W8 | 113-176 | RKLHESMDKGVTEVYGWKDINLNHDFYNTKHGIRYKISEEAQHEVLKRLLELNHELYEKELKRK |
| A0A0M9E0B4 | 1-93 | MRELHKQMDEIVLQAYGWQDINLTHDFYEVDYLPENDRIRYTISPKARKEILQRLLKLNHEIYEQEVKAGLHTKGKGKKKKTKINDK… |
| A0A380BU80 | 1-106 | None |
| A0A844IUK9 | 202-299 | None |
| A0A848F8B8 | 47-131 | None |
| A0A0B0EH85 | 14-110 | None |
| A0A658G6N0 | 72-162 | None |
| A0A1C2K7M8 | 414-497 | None |
| I0I9I7 | 19-81 | None |
| A0A519QNC7 | 197-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.