DPCstruct | MC1244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 503 ± 53 aa |
| Standard deviation of domain lengths | 52.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00994- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8AF91 | 5-497 | EAIERIPDPIVVDKARKAVQVLRRVCALYPLDKIAFSFNGGKDSTVLLHLLRAAVAGGAEAQGLGGIQSFYFRKADDFEEVKEFVES… |
| A0A7S2ZFP0 | 6-423 | REGYSSALALYDRIKREEAVGSGFARKLKVSIGTIEGALRLYGEDEISIAFNGGKDATVILHLYRAVVANFVREEDARNQLSEQEKA… |
| A0A5D2CYY5 | 705-1203 | None |
| A0A5J4Z182 | 27-602 | None |
| A0A813H913 | 31-592 | None |
| A0A1Z5JV16 | 31-553 | None |
| A0A7S0CMU9 | 20-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.