DPCstruct | MC12437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 22 aa |
| Standard deviation of domain lengths | 21.94 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 68.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7LWB4 | 28-124 | NRINRYRSRTETAAGTEHGVKPLEREKRSHQGMDGDKDPRYKEKFIQHLTGPLSFHPKCRKQFNRIYHSTRDCTTPAYYRRCAVLLV… |
| A0A2K6TMI1 | 1-73 | GPAPEQRVEIVARDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCME |
| A0A3Q2L2L8 | 474-576 | None |
| A0A6I9JMY1 | 34-167 | None |
| A0A286XDR0 | 156-255 | None |
| A0A3Q2Y8W1 | 1-89 | None |
| A0A7N9CB98 | 177-282 | None |
| A0A493U3Z6 | 378-477 | None |
| A0A3P9M6F7 | 121-208 | None |
| A0A3P8NT28 | 34-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.