DPCstruct | MC12435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 96.87 |
| Assigned Pfam label(s) | CL0055- PF11918- PF02271- PF04709- CL0333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YWA7 | 1-95 | MHVDFNQIGWGSWIIFPKRYNAYRCEGPCPGPLGEHLNPTNHAYMQSLLKHYHPDKVGSPCCAPTKMSPLSMLYYENGEMLLRHHED… |
| A0A6P3IZ89 | 27-167 | KEFTEKDPSLLLRRARQAGSIASEVPGPSREHDGPESNLCSLHPFQVSFQQLGWDHWIIAPHLYTPNYCKGVCPRVLHYGLNSPNHA… |
| B0ZE98 | 22-157 | None |
| A0A7R9NZL2 | 267-407 | None |
| R7TVW3 | 1-136 | None |
| A0A482WJ53 | 204-314 | None |
| A0A5J5CMN4 | 260-357 | None |
| A0A5J5CH14 | 478-582 | None |
| A0A3G1PW81 | 363-466 | None |
| A0A2C9JVU1 | 235-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.