DPCstruct | MC12434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7GL10 | 11-77 | HRKPCTLCNEKRDVLIRCQIDSTGAWHMVCPGKCWRDVSGGMVDGDQTEEHKYYRYGGMWKNKHEAV |
| C0BHN3 | 2-52 | KKKECEKCKNNFRIMYRVQYKSDKIWVFLCNDCAIEVRRDNEDYRYGGTWK |
| C1EAQ8 | 177-243 | None |
| A0A7S1FAF4 | 152-224 | None |
| A0A7S1UPR9 | 267-333 | None |
| A0A2P6NWW4 | 54-123 | None |
| A0A6G1J0C4 | 1-51 | None |
| K0TH78 | 619-687 | None |
| R1D000 | 135-196 | None |
| B7FZF4 | 299-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.