DPCstruct | MC12433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093XZR9 | 4-101 | SAPLIYAELLPNIRQISVLAALPTPSNSRTSVSLSSDRAVLTLVHNGATASLQLPGAIAPSYTPTQPHPNLAQLSWRIPLETSLSQP… |
| A0A3M7GHK6 | 1-145 | MDDSSGHASSSSSSAAAAAAADRPRIHLYAEHLQNIRTLSIQASLATFSNTETKATLSADGNQLSLSHEGETATIHLPITIPGGHND… |
| A0A2J6QJN8 | 2-103 | None |
| E4ZVZ3 | 92-212 | None |
| S3CHW0 | 580-698 | None |
| A0A364NCG9 | 414-515 | None |
| A0A0J8U3A9 | 3-116 | None |
| A0A1B7NX07 | 5-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.