DPCstruct | MC12431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7DY74 | 7-101 | SLDDLKAFHPILDNLGRRHGKLESSSGFRLYYWSVFLECSIHHVRLALLSSKVDRWNNTDVDNVVILWRYLISGICERIKRGYLTNI… |
| A0A0R3PZJ3 | 1-95 | MSLDNLSALDPILTNLGRRHGKLEASGKFRSYYWTTFLECSIYVFRKTLTQSRKYPDKDIDTAITLWRNLLRDVMKKIKVGLSFSFL… |
| A0A183FU30 | 35-128 | None |
| A0A0N5AVJ1 | 12-128 | None |
| A0A0N5DBD2 | 36-141 | None |
| E3CU26 | 3-107 | None |
| A0A2H2HZW5 | 8-115 | None |
| A0A0N4VP67 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.