DPCstruct | MC1243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 212 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7NHG3 | 4-208 | RFPDALCDRLLDFDENVRKQVVDAICDVSCHAWGFVSDETTRLIAEHLRDKSLLVRSYAMERLAEIFRLHCLMCSEASISSSESNWI… |
| A0A673U8L4 | 142-379 | QCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRW… |
| A0A1B6J666 | 11-260 | None |
| A0A453G0Q8 | 260-467 | None |
| A0A1X7SQX5 | 1-206 | None |
| A0A368FI20 | 131-335 | None |
| A0A0K0D1H2 | 3-205 | None |
| A0A0D8XSN5 | 44-247 | None |
| A0A5B6YQ09 | 53-263 | None |
| A0A0N4W335 | 262-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.