DPCstruct | MC12427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 262 ± 49 aa |
| Standard deviation of domain lengths | 48.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3PPQ3 | 14-268 | CFQAMEFLLCCLDFLSIQILSEQKADDKYNKALADEFYTAQSKMLAYLSIMGKIREVTACTFLFMDQILANGDRFVNGVLSLLEQCP… |
| A0A834ZXH4 | 225-445 | MVAAISVPGPEMVHPRLKNHFIELKGAQVKTVSFLTYLLKSFADYIRPHEEIICKSIVNLLITCPDSVSIRKELLVASKHVLGTDFK… |
| A0A0R3QNV0 | 52-308 | None |
| A0A094HXN4 | 36-237 | None |
| A0A6P8H9X7 | 238-525 | None |
| A0A3P7IMA0 | 2-246 | None |
| A0A0R3P1F8 | 1-216 | None |
| A0A6H5KBR9 | 38-399 | None |
| A0A439D9R3 | 193-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.