DPCstruct | MC12426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 93.00 |
| Assigned Pfam label(s) | CL0431- CL0448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0SNP4 | 503-618 | KRVQAAHYKQDEVQVHCYDEYKAHVDRTGLVSGQKARVRIFCLAFVSGMPWVEIGLNDRRREGLEVVRRKDIMPMHTDRWIRLEQCE… |
| A0A0R3PIY7 | 93-220 | STIEDILFKCPAKRETKPVYKQDEVQIHCYDEYSAFIDKEGILSQQKARVRLFCLAFVTGSPILEIGLNDRRRQGKEIVRRKDILPM… |
| A0A2P6NJ18 | 117-288 | None |
| A0A1V9ZPX2 | 911-1039 | None |
| A0A044U4B9 | 1226-1340 | None |
| A0A813FGT3 | 346-483 | None |
| A0A2H5P4M2 | 1-173 | None |
| A0A5E4ABN6 | 100-228 | None |
| A0A3Q7EP44 | 133-278 | None |
| A0A482UWN7 | 19-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.