DPCstruct | MC12425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 450 ± 31 aa |
| Standard deviation of domain lengths | 30.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4X7C6 | 274-727 | NFWGCSQTQVCPPIITQERSTQWTTVSGDRVIVQFDHCRDFVIPICEEFIEHCAEGALSVEVWGHRSAGFTSSIPTTLDVVDSQLAK… |
| A0A0R3PGF7 | 1-511 | MLVVAPVFNPPQTSESQIQQTTFVFDHEKDFKVIVTEEFLEYVQDDALSIEVWGHRNGGVLEMGEPRLDAEEKNKSLQARWSEVSRR… |
| A0A834PU01 | 570-1028 | None |
| F1KQE1 | 152-636 | None |
| A0A0M3IPH9 | 40-511 | None |
| S4RE50 | 289-741 | None |
| A0A4W5Q777 | 19-431 | None |
| A0A6H5HKJ0 | 456-864 | None |
| A0A7R9PK53 | 687-1095 | None |
| A0A815B7T5 | 332-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.