DPCstruct | MC12424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812NJ61 | 2-68 | VDRPDGIFLFRLHKERVFYMSERVLKHSGHIPKKELLSAGVCIGKFTHSRKFRLLITALDYLARLAQ |
| A0A0R3PFW1 | 1-94 | MRPLTDEETEKVFSKLATFIGDNVALLIDRADGDYCFRNHKLCLERVYYCSESLMRQAGCIAREPLLSFGTCLGKFTKSHKFHLHVT… |
| A0A1I8J1F8 | 2-88 | None |
| F9G0M4 | 352-446 | None |
| A0A0L0S631 | 72-161 | None |
| A0A3Q1NH17 | 1-102 | None |
| G3HQD6 | 1-91 | None |
| A0A6V8H002 | 1-93 | None |
| A0A7R8X4H1 | 672-765 | None |
| A0A7R9CCC1 | 465-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.