DPCstruct | MC12421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q19281 | 19-162 | KSGNPYKTKKYKCVEVSDDEEIRIVPKKKPVTSKYPWKTEEEKINRKNEDFRSTESIEMPMAKKVKTQKISTTTPPTVSDVQRDSKG… |
| A0A0R3PDV8 | 1-143 | MRLLVILVACSSTGYAYENKNPLKTKKYKCLEVDDEMEIQIVPKQVIKGKAMTVFQRPLRKENRGRPIVSQKAQDIPRDKEGRQLLL… |
| A0A0N5ALY9 | 38-157 | None |
| A0A0K0EBJ4 | 64-215 | None |
| A0A1I7RKQ3 | 75-211 | None |
| A0A3P7JG73 | 1-128 | None |
| A0A7E4ZTX3 | 139-280 | None |
| A0A0K0ESA2 | 281-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.