DPCstruct | MC12419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 133 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9XRV8 | 12-143 | YNTVGNLLRFYKAYKSSGEPLTTFYKKHNATLTRGQHTCVGLGLKLLERLNSIYPHLAGKFFIASSEEAVEELPLYLGRPPWDPHDV… |
| A0A1E1WN40 | 38-175 | YDSVNNFLTLYDAYMASPDPALHEFFQKYNPPIRPKKNTCVGLGMEVMKKLKVLEKDFPGITKSMMLVSCDENIEDLVDYATSFPGP… |
| A0A4C1T675 | 277-414 | None |
| A0A146L8X6 | 5-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.