DPCstruct | MC12418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5GUP5 | 573-678 | VYEPPKITETKEDEEEKPPPDDNIDMLISIEINLPQYVLWFEAPTVVQWNKDEKYWSNEHIYDIRFNEEKQLISCRIGKTDPIGLAA… |
| A0A6P7HH05 | 1-123 | FVPKQLEYVEFYVNYMPPQPTDPDVRKPPEEIEEDMKKNEEALDSLIFITLTWPKHVIFLELPFVCVWDDKENWWSTRCVHDLKHNE… |
| A0A812AN40 | 457-584 | None |
| A0A815LIJ5 | 1-115 | None |
| A0A5B7DHF4 | 160-276 | None |
| A0A7R8CRR8 | 365-491 | None |
| A0A194PTG2 | 9-129 | None |
| A0A2R7VQH9 | 640-741 | None |
| A0A820TLG1 | 304-429 | None |
| D6WYQ6 | 909-1019 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.