DPCstruct | MC12416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 171 ± 29 aa |
| Standard deviation of domain lengths | 28.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 84.44 |
| Assigned Pfam label(s) | CL0599- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XFA8 | 10-166 | IMWTMGDDFNYQYAESWFRNMDRLIHYVNKDGRVHALYSTPSIYTDAKHASNESWPLKQDDYFPYADSTNAYWTGYFTSRPTFKGYV… |
| A0A6P7HDP6 | 12-169 | ITMGEDFNYQDAATWFKNLDKLISYANLRQSNGSRYNLIYSTPSCYVKAIYDETKGKKKWYVKQDDFFPYASDPHAFWTGYFTSRPT… |
| A0A815T6D4 | 1-162 | None |
| A0A821ES73 | 115-312 | None |
| A0A6P8CAY3 | 184-373 | None |
| A0A1B0C107 | 27-263 | None |
| A0A654HKJ7 | 61-241 | None |
| A0A7R9Q162 | 62-232 | None |
| A0A7R9PXK6 | 162-381 | None |
| A0A7R9KAU0 | 223-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.