DPCstruct | MC12415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RGV4 | 535-625 | WARVSPVQALSYFSRQYPPHPITAQYAVRVLSSYPADAVLYYIPQLVQSLRHDTMGYVVEFIKYIAKKSQVVCHQLIWNMKTNMYID… |
| A0A6A4V1X6 | 912-1004 | WAKLPPVRALAYFSRQYPPHPITAQYAVRVLSSYPSDTVLFYIPQLVQAVRYDTMGFITEFIKRACAKSQILAHHVIWNIETNKFRD… |
| A0A654GKD3 | 835-936 | None |
| A0A183TNA2 | 143-242 | None |
| A0A822BCC5 | 756-848 | None |
| A0A453H6Y3 | 36-124 | None |
| A0A498SEZ0 | 889-980 | None |
| A0A822FW06 | 128-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.