DPCstruct | MC12414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 207 ± 58 aa |
| Standard deviation of domain lengths | 57.61 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FSB6 | 1-166 | MSLMGNLFFSSLLAPSRSDDDDTESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRKALLQAASREPECTGQLIQELQSAA… |
| A0A6P7HBY0 | 20-231 | CSRILDVCSESESDIEPSTLSSVWPDIQADSSDDESIDSENEDLLKHANVYTAEEITLLARDKLIKLQSLYIEQYRYLQYLLTKKRR… |
| A0A182FFR1 | 175-424 | None |
| A0A7R8XE30 | 321-637 | None |
| A0A1P8AVI7 | 2-223 | None |
| A0A388L031 | 62-276 | None |
| A0A2N9GFV6 | 2-153 | None |
| A0A843UBD4 | 64-248 | None |
| A0A4S8JD18 | 116-305 | None |
| A0A218XI14 | 18-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.