DPCstruct | MC12412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146LTF1 | 19-136 | NIANGRRMCTKELDKPVKYSASKAAAWKAEFSRSGGESSDNEAAWFQTYAVTGSVAAFLIYFCVLREESDIDDQLMMPLYDKIDGLE… |
| A0A6P7HA63 | 13-140 | VKVPNDIVRRNISCSSRVFNQEFQNDRPVKFSASPASHYKAQSSRTGVHYESRLWYEPYVIIASISVFLIYFTILREENDIDEELSR… |
| A0A7R9ABC3 | 62-202 | None |
| A0A7E4RH89 | 1-116 | None |
| A0A444T5B4 | 129-262 | None |
| A0A7I8V9E1 | 25-165 | None |
| A0A7R9E1G7 | 121-253 | None |
| A0A653BUT9 | 10-142 | None |
| A0A835CTA3 | 27-139 | None |
| A0A811LLS8 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.