DPCstruct | MC1241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 371 ± 67 aa |
| Standard deviation of domain lengths | 67.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 64.55 |
| Assigned Pfam label(s) | PF21188- PF18149- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819LVP0 | 2-313 | NSSLHDQHERNKSTGEVQSLAEDLKDFRMGDRVQHTRPESINKKQKKDEDHSSTYDINRFKRQTLLSHLTDDTSTILYQPKTYETKQ… |
| A0A7J7NDL4 | 1-353 | MLIQLPRLSNSLRDHFDIDQAYLKRKQILQNLITQRPVNTLEDSKLARKIVYQWEEASSEVRQVYKQFVGAIVELIDGEVSSEEFRE… |
| D7LM54 | 81-589 | None |
| A0A0A9YUY1 | 1-362 | None |
| A0A314Z3Q5 | 8-318 | None |
| M7BN55 | 25-313 | None |
| A0A3M0IW95 | 51-487 | None |
| Q6GLE2 | 2-330 | None |
| A0A6V7HCS3 | 18-294 | None |
| A0A0N4WKC7 | 16-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.