DPCstruct | MC12408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7H6P9 | 1-86 | MSKRHVAYIKPDEPSFLKKLKREAGYIEGPTVDTKRENYGEVSQEDLLDTEEEKPTVVVLKPGDLTAEEAQLEEERLKKGKSYFFT |
| A0A6J2Y239 | 1-83 | MSKRHNIAYVKPTEPTFIRQLKEQIGYKEGLTVDTKREDIGHVDEDDLQDTEEEQPQVVVLNSGDLNAEEVAQEKLRLEREEQ |
| A0A3Q4AI50 | 1-80 | None |
| F1Q4N6 | 1-84 | None |
| A0A811V272 | 60-145 | None |
| A0A803XQL7 | 1-87 | None |
| A0A4Y2S8K8 | 1-75 | None |
| A0A6V7H093 | 3-83 | None |
| A0A7M7GR99 | 18-103 | None |
| A0A803V823 | 65-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.