DPCstruct | MC12406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 185 ± 28 aa |
| Standard deviation of domain lengths | 28.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0RM47 | 261-473 | PPCQGICDVFSCEHGSCNHPCSDPCAACTERCSWSCKHSGECSLPCGAPCNRRLCDLRCTKALTCGHQCPSVCGEDCPSREFCHICG… |
| A0A6P7H5I1 | 1-159 | CKEACVRKCEHQECKRRCGEICNVPPCYKPCPKKIRRCRHPCIGFCGDPCPSLCRICNAEELTEFFFGTEDEEDARFVLLVDCGHIL… |
| A0A6J3C2U0 | 2-131 | None |
| A0A7M7N432 | 267-473 | None |
| A0A2I1E534 | 502-698 | None |
| A0A2G8LS10 | 58-249 | None |
| A0A835Y6R4 | 9-206 | None |
| R7QII7 | 6-212 | None |
| A0A0M3I8I2 | 367-570 | None |
| A0A8A3NXW6 | 56-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.