DPCstruct | MC12405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 46.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7H5B8 | 13-165 | AAQEPAFELPVELIGFPVIIVAVRLSNFVKKLAYSLNPSTYRRTRRAISSDEMINMIEAEKRLVSELGENVCIYPKVCLHHAEKASK… |
| A0A2R7WAX6 | 6-115 | QDTYRSRGKRGLPAPMDPGEVEKRLVAEMGEKVCVYEEVCSQYAIQSLQPEADVHLDWEEIFRKFATSPRDKADFYLLSVFLGDIVG… |
| A0A194R4E3 | 21-188 | None |
| A0A6A4JNQ3 | 18-169 | None |
| A0A2W1BPM9 | 1-134 | None |
| A0A1B0BIP5 | 31-166 | None |
| A0A139WPK3 | 149-301 | None |
| A0A194QD88 | 130-282 | None |
| A0A811WB75 | 65-229 | None |
| A0A1S3DGY6 | 28-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.