DPCstruct | MC12402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7GZS6 | 27-137 | KSAMVKENLIGQNEELMTENLDDCGLRFLLAMKHYGYLLRCLPLAQRTQFQKQGVGNNNLAWAFHSESQEELLNLIPSYAKGEPTWP… |
| A0A1U7QYA6 | 8-103 | TGRDTLDECGLRYLLAMRLHTCLLTSLPPLYRAQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNVN… |
| A0A812QLG7 | 1-123 | None |
| A0A3Q0J1A3 | 308-414 | None |
| A0A0N4VT90 | 1-141 | None |
| A0A7R9AWJ0 | 724-831 | None |
| A0A818IKL7 | 72-190 | None |
| A0A453EVS9 | 136-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.