DPCstruct | MC12400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 221 ± 19 aa |
| Standard deviation of domain lengths | 19.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6DA79 | 2-198 | MFLSISTQHQEASDLGYLFHKHPDRVHKLDLPFGKAIVFFSELSVERSTIVLQFEVDSIGLVRGFGGRDNSQVDLYVNDRPYVSSSL… |
| A0A2T4DU27 | 1-228 | MLLNISTTHNPATDLSFLLHKHPEKLQSVELATGKAHIFYSEATTDNCSVNLLLDINPIELVKNNRNNSSDFALAHYVNDRPYVASS… |
| A0A1H2D1L1 | 2-263 | None |
| A0A7S8EB50 | 4-198 | None |
| A0A1Z4TG39 | 1-222 | None |
| A0A1C6QC08 | 49-281 | None |
| A0A841GWH0 | 1-199 | None |
| A0A4R2JMZ3 | 1-225 | None |
| A0A229TAV2 | 214-436 | None |
| A0A7X0D3B3 | 1-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.