DPCstruct | MC1240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 143 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 95.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C7Q1K7 | 428-572 | LTASLLTRLAGNGPTGPNATLQAHFSHGLPWQISVIVSSQPTLAAATGSTSSFAVPTRFNGDILSTMQAQYADGSNAGPANWTSYLE… |
| A0A0M0KD39 | 1-155 | MKAHVLSAIAGSGTLGSNGMVTAEFNRGADWHFRVNTYRTPVLQSTQGHVSNFSIPASFNGNSLATMEAVYVDGGNAGPQDWTSFKE… |
| M7SUG5 | 1-139 | None |
| A0A3N9Y330 | 195-334 | None |
| A0A1H7IEY0 | 207-343 | None |
| A0A5R9LUG3 | 154-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.