DPCstruct | MC124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16132 |
|---|---|
| Mean domain length (aa) | 192 ± 37 aa |
| Standard deviation of domain lengths | 37.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.64 |
| Pfam Score | 94.49 |
| Assigned Pfam label(s) | PF04931- CL0219- PF11899- PF05890- CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D8TUW6 | 2-185 | LDLACGFGFFGREIYRRGAAGVVGVDISEKMIELAREESRKYGDPLEFHVRDVANMEPLGQFDLVNAAWLFNYADSVENLRKMFKVV… |
| A0A1G6WKE3 | 47-254 | KWATGIYDLVIEYFTRGRALRRLSVDAIAPAAGEAILDLGCGTGELSLALAQTEPKSSITGYDIDPEILEIARNKMGLQGEVSAVTF… |
| A0A2J8AA05 | 53-324 | None |
| A0A7U4QLZ7 | 229-452 | None |
| A0A811N0I3 | 38-199 | None |
| A0A7W1E5H6 | 6-171 | None |
| A0A811MZD3 | 65-241 | None |
| A0A811MFW6 | 114-301 | None |
| A0A654HUP7 | 357-538 | None |
| A0A811MFI2 | 18-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.