DPCstruct | MC12398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6B9H8 | 2-81 | QERVTKSQATRLVALAADVELFHTGEIAYTRVPVGTHHEVLGLRAAAFKRWLGRQSYQASGAAPTAAALQDALGVLESQA |
| A0A1J0AA51 | 330-417 | NDEPEGEKTSKKSVAKLLIGIAQNECDLWQSDTGEGWADILIEGIRHSHPLRSGRFRKWLAGRLWADHELPSNSEAMQSCLTVLESFT |
| A0A3A9C0F8 | 55-161 | None |
| G7WRL0 | 426-513 | None |
| A0A4Y7RPD0 | 1-88 | None |
| A0A6L9EQ27 | 26-129 | None |
| A0A6F8V077 | 1-97 | None |
| A0A557XD47 | 1-90 | None |
| A0A1Q3SF34 | 514-631 | None |
| U7NKW3 | 90-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.