DPCstruct | MC12396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 144 ± 22 aa |
| Standard deviation of domain lengths | 21.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LK76 | 13-152 | IEKLPLAVRKDIRDNYENNREDFEKTISELLGTTFKLNLNPNEIWAYATDSNGSAGGILAGYVNGFIYNLKRFTEKYDDDGKAHFNN… |
| A0A4Q6CK14 | 20-148 | FAQGVKQKKALAEANQLISSYSDKLKENCGQDIKASLNTASFGNEETMKTATWGKDTMWALSSLCEDKDYKEAITKGVKQVVFKYDA… |
| W7MTY1 | 10-195 | None |
| W6R9Z4 | 13-128 | None |
| A0A1E4SMZ2 | 1-145 | None |
| F4PYM9 | 4-137 | None |
| D3BBJ0 | 3-133 | None |
| A0A0S6XC60 | 100-236 | None |
| A0A397JDH4 | 310-441 | None |
| A0A0D2Y5I8 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.