DPCstruct | MC12390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 159 ± 35 aa |
| Standard deviation of domain lengths | 34.92 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497AUT4 | 136-315 | SLMIAAHAQLARHYGLPSRSGGALTDASYPDAQAGFESMLALLTTINSGVDFVLHAGGILSSYLAFSYEKFVLDDEMCGMVRRLQRG… |
| A0A509L3J3 | 55-235 | ASPEDAKHTAIVTALSQYYNIPCRSQGALTESFSLDYQAGMESSMMLTTAALSGVHVSLHACGTYGSMLAMSFEKFIADEDLCCAIK… |
| A0A3G1L296 | 3-127 | None |
| A0A0E2NWW1 | 3-264 | None |
| A0A538IUJ3 | 413-600 | None |
| G1V4N2 | 10-155 | None |
| X1J9B1 | 1-96 | None |
| A0A2E8H681 | 175-355 | None |
| A0A356V653 | 60-203 | None |
| A0A350WSY4 | 31-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.