DPCstruct | MC12386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 407 |
|---|---|
| Mean domain length (aa) | 247 ± 50 aa |
| Standard deviation of domain lengths | 50.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.64 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | PF06155- CL0111- CL0029- PF05141- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8EE08 | 17-279 | VDLRALDEPAFAAIHRAWLDHQVLLFRQQALADADLVAFSRRFGDLDEAPVQETGRRFVDGYPEIYVVSNVVKDGVPIGSLGSGEAV… |
| A0A0M9WC55 | 96-366 | EIVGLQLKDLTDQQKDELGLLIAERSVVFFRGQDITPQQQKQLGEWFGEVEIHPQVPHVPGIPGVTVMWPALQETETPASFRRPGGA… |
| A0A438NE88 | 18-335 | None |
| A0A438MUP2 | 185-532 | None |
| A0A1V2LHT5 | 533-875 | None |
| A0A7S2RQ22 | 47-384 | None |
| A0A6B0SAP9 | 164-378 | None |
| A0A2G7GLA6 | 933-1247 | None |
| A0A0D0GC36 | 18-204 | None |
| A0A6S7FSR5 | 99-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.