DPCstruct | MC12385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5QRA8 | 21-112 | AQPDIIYTWTDEAPMLATHSFLPIVRGFAQRAGVSVGTADISLAGRILAAFSLADDDLARLGELTQSPAATIIKLPNISASLPQLKA… |
| W4ULR2 | 1-115 | MPTIVWTKIDEAPALASYSLLPIVEGFLDESGIDITTSDISLAGRILAQFPDRLNEDQKVADHLAELGELTGSPDANIIKLPNISAS… |
| A0A0M3C3V7 | 2-99 | None |
| A0A537N5K4 | 1-100 | None |
| A0A7S4E7W1 | 133-230 | None |
| A0A7R7HPA7 | 1-101 | None |
| A0A3B9C8Q9 | 1-102 | None |
| A0A7V3CY13 | 2-99 | None |
| A0A813ATT5 | 2-100 | None |
| A0A6S8BB53 | 120-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.