DPCstruct | MC12384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 120 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.58 |
| Pfam Score | 84.29 |
| Assigned Pfam label(s) | CL0063- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H0T3 | 158-266 | NPDQPKTVFGFLCAALARRRAQGTPAFTLMSCDNLPHNGAVTRKALLAFATLRDAELHDWIKANVSFPNAMVDRITPMTSAAHRLQL… |
| W4UI44 | 172-295 | STAMGLVTALLVQRFHAGATPVAVVSCDNFSHNGDMLRTSVLTIVAEWEKRGVIDHRVVEWIAEKVEFPISVIDKITPAPSQKVAEQ… |
| W4U5X0 | 10-108 | None |
| U6LW67 | 6-96 | None |
| A0A4U9CV90 | 49-181 | None |
| A0A0A3YKM0 | 11-141 | None |
| A0A447PUB1 | 46-152 | None |
| A0A815N1C4 | 259-404 | None |
| A0A6L5X4B5 | 175-322 | None |
| A0A377DB53 | 96-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.