DPCstruct | MC12382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 190 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660NVT3 | 1-172 | MLVSCALMIMFCKAKPKKAISVPVWQNGMVAVVAIYGIAWMSNTYFDNYQAEMQQLLGGIVHEYPWSIAIAFFAVSVLINSQGAVVV… |
| W4UF30 | 1-183 | MLTKPPMTSSAAIMLIMLTTAMIICMMSREDVKQLTTQTTFRAGMSAAICILGLAWLGNMFVNNYMDVLTHAGASILHSAPWFLSVI… |
| A0A7I8B2B9 | 87-291 | None |
| A0A376TNX4 | 3-199 | None |
| A0A011P4S2 | 35-237 | None |
| A0A5L8LM00 | 111-318 | None |
| A0A0B8PA91 | 123-325 | None |
| A0A2X3CNW6 | 23-204 | None |
| A0A7Y0CW81 | 125-300 | None |
| A0A447LIG9 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.