DPCstruct | MC12381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4M7I5 | 118-189 | TMVRLAQDWSLRYCLVDGQGNFGSVDGDRAAAMRYTEARLHELGELMLADIDEDTVEWGPNFDESLKEPLSL |
| A0A1E4CKW4 | 88-158 | LVRMAQPWVMRYPLIFGQGNFGSLDGDSPAAYRYTEAKLTAVAMEFVQELGQETVDMRRNFDDSQDEPVVL |
| W4VE73 | 3-70 | None |
| A0A2V6E1I9 | 37-108 | None |
| A0A1A9Z1G2 | 2-69 | None |
| A0A0H1SC17 | 2-75 | None |
| A0A0K2RDV5 | 116-175 | None |
| A0A4V6KUM3 | 100-161 | None |
| A0A6D0ELB3 | 3-65 | None |
| A0A3N5MJD8 | 86-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.