DPCstruct | MC12380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 389 ± 64 aa |
| Standard deviation of domain lengths | 63.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 97.89 |
| Assigned Pfam label(s) | CL0260- PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4UES8 | 79-471 | SDICNAARSMGVPVGPGRGSAAGSLVAYLTGIIAINPLEHGLLFERFLNPERVNPPDIDLDFDDRQRDKVIDYVTHKYGAEYTSQVN… |
| R7NN30 | 2-269 | FKAGTIATVADKTAIGYVKKYEEEKGRVYSKTEELRLASGCTGIRRTTGQHPGGMVVVPKGKEIYDFCPVQHPANDMKSDNVTTHFD… |
| A0A7Y2DHU4 | 47-504 | None |
| A0A6G8FWJ1 | 128-596 | None |
| A0A4R8EUP3 | 418-867 | None |
| A0A0G1XS63 | 2-311 | None |
| A0A6M0EMX7 | 332-726 | None |
| A0A3N5X9S5 | 213-649 | None |
| A0A3B0B0L2 | 269-762 | None |
| R5FW09 | 14-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.