DPCstruct | MC1238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | CL0175- PF08265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O59669 | 10-136 | VQKRKKQKQRSVVDPVTRERQLKRNLADLEKDNFSDIRFEIPKDLLQRRVLPISVRRILSSRKTFVNYLDETPNSRYNTCVAKPSYK… |
| A0A1Y5IE80 | 3-152 | RVDAATRAEVAAARLDSFESDVAIVPGQDGDGGVDSDDEEFVFNENARDGEATMVKGKKKGTRTTRGAAEHKRAAAARTFNALLEQS… |
| A0A674AVI5 | 9-137 | None |
| A0A4P9XAI2 | 9-165 | None |
| A9D699 | 3-191 | None |
| N1J943 | 73-264 | None |
| A0A2Y9J5J8 | 25-187 | None |
| W7TJ72 | 29-186 | None |
| A0A2N1NKQ7 | 144-269 | None |
| C1MMA2 | 2-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.