DPCstruct | MC12379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4UEQ4 | 1-95 | MTTAVYIEVNHEDLATVGAFVREGVHRPVFDLAMIFAANINYDGCTAYLHLNERVMETLRAAETQIRPLQRRGTKVLLSLLGNHERR… |
| D4IQ34 | 345-429 | IRNICYFEVNDCNPLNAIEYILEDGQPFFDAVVLFAGNINWDASKQKVYMNANPNVQALLDNSEELLQPLRKKGIKVLLDILGNH |
| A0A1H8YDL8 | 86-166 | None |
| A0A3D9DQK7 | 27-112 | None |
| A0A173W8V9 | 41-137 | None |
| A0A7V8F415 | 1-113 | None |
| A0A1Y3VF10 | 1-129 | None |
| A0A4Q0ISU4 | 195-279 | None |
| R6EC92 | 111-195 | None |
| A0A6G7LSJ0 | 109-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.