DPCstruct | MC12377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 217 ± 19 aa |
| Standard deviation of domain lengths | 19.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455VAC8 | 110-319 | ESRELFIRRALVEGEFQTKGEFFTHNRALIEEVEALEDRARRRDILVDEETLFAFYDERIPADIVNGKGFEHWRKQAERQDPTLLKF… |
| A0A2J6NE69 | 189-395 | IAHEIFVEEALLNYRLNRTFLFLEHNRALVEKIRTLEDKLRQKNILVPEKQLYDFYSGRLEGVYSLEGLERRIKNAGSDDFLRFKEE… |
| A0A3G6XZ44 | 58-263 | None |
| A0A3T1DTQ2 | 315-524 | None |
| A0A831M557 | 501-713 | None |
| A0A7G9QR45 | 785-1057 | None |
| A0A844F4E5 | 266-475 | None |
| A0A2N6V0Y8 | 225-444 | None |
| A0A3E1E5S2 | 650-854 | None |
| A0A1S2WVC4 | 350-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.