DPCstruct | MC12374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5Z5H5 | 124-207 | INGPAWAGDDLAGMLAGRVLPFVQDDAQQNVWANWNADWRDVFILDRAGQLANRINLTGFNPDPGVNQGQNYALLKSMFLDARG |
| A0A381ZML6 | 5-78 | EGEISGMIQNRVLPWAQDNEDSHVWDTWNITLRDFIVLDINGDFFYKINLTDVDPSIESNYENLKQLLLDARSN |
| A0A2E5JQS2 | 4-65 | None |
| A0A2E6VQB7 | 10-85 | None |
| A0A2D5UQV0 | 19-105 | None |
| A0A2E8D4Q8 | 1-101 | None |
| A0A2D6LYX8 | 1-87 | None |
| A0A849Z3P7 | 16-93 | None |
| A0A2V5MWS4 | 11-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.