DPCstruct | MC12372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 29 aa |
| Standard deviation of domain lengths | 29.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P12940 | 2-121 | GKKRPWKCCDEAVCTRSIPPICTCMDEVFECPKTCKSCGPMGDPSRRICQDQYVGDPGPICRPWECCDKAICTRSNPPTCRCVDEVK… |
| A0A3B6EBP3 | 48-191 | AAASRPWDCCDNTICTRSLPPICICLDEVDECASTCMACVPSVSNPFRRVCGDRYYGDPGPKCTYNTVAGDNNDDALVAAAAEEEKP… |
| A0A077RU50 | 43-184 | None |
| A0A453DSU2 | 2-110 | None |
| F2DJ59 | 17-204 | None |
| A0A0A9PJC7 | 23-237 | None |
| A0A077RU58 | 4-127 | None |
| F5BCP7 | 11-172 | None |
| A0A0D3EJ36 | 115-243 | None |
| A0A835BZM4 | 80-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.