DPCstruct | MC12371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 488 ± 108 aa |
| Standard deviation of domain lengths | 107.83 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 89.12 |
| Assigned Pfam label(s) | PF10146- CL0027- CL0031- CL0266- PF12578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8DZ82 | 15-566 | TVSASRSINAYTPTRLVVKFKDLRSWTLGGDVTRLLPALNRHAYVDTPLNLFAFTSIGAMQEDLQGHALYDLYEDFARMGVALRDGS… |
| A0A6J1UIA5 | 12-459 | EQRLEIFQNLITRAFPLSHGLPFFAFTYKEKFPTNGWKVYDPVAEYKRQGLPNESWKISKINSMYEFCDTYPAVLVVPTSVKDEDLS… |
| A0A6P4EEV9 | 61-700 | None |
| A0A099P6S6 | 195-576 | None |
| M2RDT6 | 481-915 | None |
| A0A6P8IBS5 | 227-783 | None |
| A0A4W4DXH8 | 3-567 | None |
| A0A7S2CF63 | 1-323 | None |
| K3WV89 | 2-322 | None |
| A0A7R9KGB5 | 134-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.