DPCstruct | MC12370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7M633 | 443-533 | PFALFFFVGREFLGFHLRFRDIARGGIRIVRSRNHTQYENNLNTIFTENYNLASTQQKKNKDIPEGGSKGTILLHAANQDEAKSAFI… |
| A0A0L0NW60 | 37-128 | PYGMFFIVGSDFRGFHIRFRDISRGGIRVVRSRSVDAYNVNVRNLFDENYNLAATQQKKNKDIPEGGSKGVILLDPGLAQETPKASF… |
| A0A812QVV0 | 275-388 | None |
| G0UTT8 | 233-329 | None |
| C9SP25 | 266-353 | None |
| A0A6A4GUS3 | 1-102 | None |
| A0A6A4GKX9 | 554-626 | None |
| A0A482RGK7 | 80-170 | None |
| A0A5M9JZ54 | 712-811 | None |
| A0A7S4UFD7 | 559-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.