DPCstruct | MC1237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 335 ± 78 aa |
| Standard deviation of domain lengths | 77.69 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | PF08555- CL0077- CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358DTA1 | 3-205 | QKHFIDLSKGATPFVVLGCMFAYQAWDNPTAWAYLATHGTYGLLWVLKSQIFPDKNWEARCGIGYGMLILTGLALYWGTPWMICAWK… |
| A0A1Y5IAH3 | 294-694 | VPHFEFGGPIGALGITVVLPLVCYFLVHACNEDGCVEVGRLAREGAKALPGFPSHMPLASARGTVYALGWMAFTVMMHVLIPGAVKE… |
| A0A0B7N490 | 477-901 | None |
| A0A2H4SEA9 | 6-276 | None |
| A0A5K1JTH3 | 18-297 | None |
| A0A1I8FMV3 | 6-303 | None |
| H3AEQ2 | 13-333 | None |
| L7J8C1 | 1-460 | None |
| A0A6A4JIV8 | 12-359 | None |
| A0A5N6PPI5 | 25-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.