DPCstruct | MC12368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 521 |
|---|---|
| Mean domain length (aa) | 162 ± 34 aa |
| Standard deviation of domain lengths | 34.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 99.69 |
| Assigned Pfam label(s) | CL0010- CL0229- PF10198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8DQX7 | 9-170 | DQGFLDDPIVQCEKCSVAVHQYCYGIESVPEGDEPWFCDFCTEPNGPSADATCELCPLKRQKSAFKKTVEGKWVHVVCALWAPGVQF… |
| A0A084VH88 | 2-119 | TKTCFLCKSSEDDELLYGKFYTKYRISVHYYCLLLSSNLVQNGVNDEVGIFGFLEADIRKENQRTKSCRCYICKQMHANIFCCAKKC… |
| A0A0V0QFA6 | 23-222 | None |
| A0A1Z5RNB3 | 1-164 | None |
| A0A0K0DRY5 | 26-251 | None |
| A0A0K0EDE0 | 1739-1857 | None |
| A0A0N1I986 | 326-470 | None |
| A0A061QLU9 | 150-331 | None |
| A0A3N4IFA8 | 518-668 | None |
| A0A672UD53 | 9-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.