DPCstruct | MC12367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 182 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GL89 | 837-1009 | HGVQIDAEDDKLVGKYFKDLPSQYWELTDTRDFGARAYSYQFNGLLARLYTNCGAAEPVPGARSAHEIEHVLRSIDSPADQNQVDFN… |
| A0A0W8DM46 | 36-219 | FQAEEPKYSFANDLPPSYLSFSDIRDLGVYSYNYEMTGLLAEMFTACPGAGFGAGVPFRHLESANNTETKHKFVEAVIVPSNKTADN… |
| A0A024UQH4 | 170-349 | None |
| A0A485KXZ5 | 84-264 | None |
| A0A485K6I0 | 111-286 | None |
| A0A662WM84 | 838-1030 | None |
| A0A1V9Z033 | 61-237 | None |
| A0A6G0XR43 | 370-556 | None |
| A0A5D6Y205 | 286-472 | None |
| D0ND78 | 323-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.