DPCstruct | MC12365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 27 aa |
| Standard deviation of domain lengths | 26.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9AVD8 | 222-354 | KSSLWFHNEPWLDFNMQQNGHSTSKTVWKDISYDYNLPSPKPTLDGEPTYEQILIDLQGPGHTNDADVRRFAYLTVFAGAFGITYGH… |
| A0A0W8DI63 | 5-178 | EEDRVSIDAVQSGHATPESLGSFTPYEAGDSTKNYKLIAKMLDGFTGPVLGLENHYEGGHYNFDPSFPVWNASEVRTGLYNGVYSGA… |
| R8BSG6 | 206-413 | None |
| A0A7V3T6H4 | 57-230 | None |
| A0A263DJA1 | 588-724 | None |
| B9XFK0 | 320-459 | None |
| A0A2N2EC35 | 420-554 | None |
| A0A7W1QV97 | 65-208 | None |
| A0A1P9WRI9 | 466-599 | None |
| W2NJE6 | 81-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.