DPCstruct | MC12364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 12.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3UWJ3 | 1-105 | MHALLNEHKRPDETYRQYAFRLINIADALPGGVDVHSNAAQALLTFVNRAYPENAKFLRTIANLQTDKPIEELHRMTRELSMLVGSD… |
| A0A0W8DHG4 | 17-134 | IYSEGKRAAETYQEYADRLLMMADGLTGGLESVSNAQHALATFLRLAWPQRKDILQTHIRGKPGAPTELLNDAVHFLSELSQSDGRR… |
| A0A329RWX7 | 52-178 | None |
| A0A6G0R1Q7 | 3-107 | None |
| A0A6A3MT22 | 30-160 | None |
| A0A833SWZ0 | 12-126 | None |
| A0A6A4A745 | 634-760 | None |
| A0A225VP02 | 65-168 | None |
| A0A6A3I4K7 | 2-99 | None |
| A0A6A4DQG9 | 314-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.